compare

Comparison List

Blue102

Blue102 is a fluorescent protein published in 2010, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Discosoma sp. 26.3 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

Blue102 Sequence

EEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFLYGSRAYVKHPADIPDYWKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEAISERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Structure

Deposited: ,
Chromophore (LYG):

Excerpts

No excerpts have been added for Blue102
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Understanding Blue-to-Red Conversion in Monomeric Fluorescent Timers and Hydrolytic Degradation of Their Chromophores

Pletnev S, Subach Fv, Dauter Z, Wlodawer A, Verkhusha Vv

(2010). Journal of the American Chemical Society, 132(7) , 2243-2253. doi: 10.1021/ja908418r. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change