compare

Comparison List

AzaleaB5

AzaleaB5 is a basic (constitutively fluorescent) red fluorescent protein published in 2020, derived from Montipora monasteriata.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Montipora monasteriata 26.0 kDa -

FPbase ID: 886AH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
574 596 104,000 0.58 60.32      

Photostability

No photostability measurements available ... add one!

AzaleaB5 Sequence

MENVRRKTGIQTEMKTKLHMDGMVNGHSFEIKGEGKGSPYEGVQTMKLKVTKGAPLPFSIDILLPQCMYGSKPFIKYPENIPDYLKLSFPEGITWERTMTFEDGAVCDVSNDSRLVGNCFIYTVKFQGVNFPLDGPVMQKKTRGWEPSTEVLYECDGWMRGLVDIALKLENGGHYMCNFKTTYKSKKGLEVPPYHFVDHKLDLLSHNTDGATFEEFEQGEIAHAHLSKLA
GenBank: LC085679

Excerpts

No excerpts have been added for AzaleaB5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change