compare

Comparison List

AsRed2

AsRed2 is a basic (constitutively fluorescent) red fluorescent protein published in 2005, derived from Anemonia sulcata.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia sulcata 25.7 kDa -

FPbase ID: 8TL1P

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
576 592 56,200 0.05 2.81      

Photostability

No photostability measurements available ... add one!

AsRed2 Sequence

MASLLKKTMPFRTTIEGTVNGHYFKCTGKGEGNPLEGTQEMKIEVIEGGPLPFAFHILSTSCMYGSKAFIKYVSGIPDYFKQSLPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAGRWEPSTEIVYEVDGVLRGQSLMALECPGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEILEEVEKGKCYKQYEAAVGRYCDAAPSKLGH

Excerpts

No excerpts have been added for AsRed2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change