compare

Comparison List

asFP499

a.k.a. asulGFP

asFP499 is a basic (constitutively fluorescent) green fluorescent protein published in 2000, derived from Anemonia sulcata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Anemonia sulcata 25.4 kDa -

FPbase ID: 5W398

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 499          

Photostability

No photostability measurements available ... add one!

asFP499 Sequence

MYPSIKETMRVQLSMEGSVNYHAFKCTGKGEGKPYEGTQSLNITITEGGPLPFAFDILSHAFQYGIKVFAKYPKEIPDFFKQSLPGGFSWERVSTYEDGGVLSATQETSLQGDCIICKVKVLGTNFPANGPVMQKKTCGWEPSTETVIPRDGGLLLRDTPALMLADGGHLSCFMETTYKSKKEVKLPELHFHHLRMEKLNISDDWKTVEQHESVVASYSQVPSKLGHN
GenBank: AAG41205
UniProtKB: Q9GPI6
IPG: 188043

Structure

Deposited: ,
Chromophore (QYG):

Excerpts

No excerpts have been added for asFP499
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cracks in the beta -can: Fluorescent proteins from Anemonia sulcata (Anthozoa, Actinaria)

Wiedenmann J, Elke C, Spindler K-D, Funke W

(2000). Proceedings of the National Academy of Sciences, 97(26) , 14091-14096. doi: 10.1073/pnas.97.26.14091. Article   Pubmed

Additional References

  1. Chromophore-Protein Interactions in the Anthozoan Green Fluorescent Protein asFP499

    Nienhaus K, Renzi F, Vallone B, Wiedenmann J, Nienhaus Gu

    (2006). Biophysical Journal, 91(11) , 4210-4220. doi: 10.1529/biophysj.106.087411. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change