compare

Comparison List

amilCP-Pink

amilCP-Pink is a basic (constitutively fluorescent) fluorescent protein published in 2018, derived from Acropora millepora.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Acropora millepora 24.9 kDa -

FPbase ID: 2ZGTJ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

amilCP-Pink Sequence

BLAST

amilCP-Pink was derived from amilCP with the following mutations: C61A/Q62C

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQACYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYHVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLLGNNFMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA

Excerpts

No excerpts have been added for amilCP-Pink
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering a palette of eukaryotic chromoproteins for bacterial synthetic biology

Liljeruhm J, Funk Sk, Tietscher S, Edlund Ad, Jamal S, Wistrand-Yuen P, Dyrhage K, Gynnå A, Ivermark K, Lövgren J, Törnblom V, Virtanen A, Lundin Er, Wistrand-Yuen E, Forster Ac

(2018). Journal of Biological Engineering, 12(1) , . doi: 10.1186/s13036-018-0100-0. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change