compare

Comparison List

amilCP

amilCP is a fluorescent protein published in 2008, derived from Acropora millepora. It is reported to be a somewhat slowly-maturing tetramer.
+
amilCP Spectrum Fluorescent protein amilCP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora millepora 25.0 kDa -

FPbase ID: 18KQQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588   87,600       54.0  

Photostability

No photostability measurements available ... add one!

amilCP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYHVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLLGNNFMALKLEGGGHYLCEFKTTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA
GenBank: AAU06854
UniProtKB: Q66PV0
IPG: 3620739

Structure

Deposited: ,
Chromophore (QYG):

Excerpts

No excerpts have been added for amilCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Over the rainbow: structural characterization of the chromoproteins gfasPurple, amilCP, spisPink and eforRed

    Ahmed Fh, Caputo At, French Ng, Peat Ts, Whitfield J, Warden Ac, Newman J, Scott C

    (2022). Acta Crystallographica Section D Structural Biology, 78(5) , 599-612. doi: 10.1107/s2059798322002625. Article

  2. Overcoming chromoprotein limitations by engineering a red fluorescent protein

    Bao L, Menon Pnk, Liljeruhm J, Forster Ac

    (2020). Analytical Biochemistry, 611, 113936. doi: 10.1016/j.ab.2020.113936. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change