compare

Comparison List

amFP506

a.k.a. amFP486-E150Q

amFP506 is a basic (constitutively fluorescent) green fluorescent protein published in 2005, derived from Anemonia majano.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia majano 25.3 kDa -

FPbase ID: VQMW2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
483 506 0.67        

Photostability

No photostability measurements available ... add one!

amFP506 Sequence

amFP506 was derived from amFP486 with the following mutations: E150Q

MALSNKFIGDDMKMTYHMDGCVNGHYFTVKGEGNGKPYEGTQTSTFKVTMANGGPLAFSFDILSTVFKYGNRCFTAYPTSMPDYFKQAFPDGMSYERTFTYEDGGVATASWEISLKGNCFEHKSTFHGVNFPADGPVMAKKTTGWDPSFQKMTVCDGILKGDVTAFLMLQGGGNYRCQFHTSYKTKKPVTMPPNHVVEHRIARTDLDKGGNSVQLTEHAVAHITSVVPF

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for amFP506
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Crystal structures and mutational analysis of amFP486, a cyan fluorescent protein from Anemonia majano

Henderson Jn, Remington Sj

(2005). Proceedings of the National Academy of Sciences, 102(36) , 12712-12717. doi: 10.1073/pnas.0502250102. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change