compare

Comparison List

aceGFP-G222E-Y220L

aceGFP-G222E-Y220L is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2010, derived from Aequorea coerulescens.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea coerulescens 26.8 kDa -

FPbase ID: DH5VX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
396 508          

Photostability

No photostability measurements available ... add one!

aceGFP-G222E-Y220L Sequence

MSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMILFEFVTAAAITHGMDELYK

Excerpts

No excerpts have been added for aceGFP-G222E-Y220L
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change