FPbase: The Fluorescent Protein Database

Javascript is disabled! Many pages and features of FPbase will not work properly

2019-11-26 21:35, user: talley
- changed protein AausGFP base_name: AausGFPn->AausGFP
- changed protein AausGFP name: AausGFPn->AausGFP
- added protein AausGFP seq: MKIYCEGEKLFKGIVPIQIELNGDVNGHKFSVHGEGQGEAEMGRLTLRFVCTTGKMPVPWPTLVTTFSYGVQCFSRYPEHMKMHDFFKSAMPEGYTQERTIFFDKDGTYKTRAEVKFEGDTLVNRIELTGTGFKEDGNILGHKMEYNYNSHNVYIMSDKAKNGIKVNFKIRHNIEDGTVQLADHYQANYPLGKGPVLLPEDHYLSTQSALTKDPHETRDHMLLLEFVTAAGITHGMDELYK
- changed protein AausGFP seq_validated: False->True
- changed protein AausGFP slug: aausgfpn->aausgfp
2019-11-26 21:35, user: talley
2020-02-14 15:29, user: geobellward
- added protein AausGFP default_state_id: 933
- added protein AausGFP parent_organism_id: 1246302
- added protein AausGFP primary_reference_id: 613
- added State AausGFP
2020-02-29 17:46, user: talley
- added protein AausGFP agg: d
2025-04-10 20:32, user: ITAbrahams
- added protein AausGFP aliases: JFP, Jade Fluorescent Protein, wtJFP
2025-04-10 20:32, user: ITAbrahams
2025-04-10 20:32, user: ITAbrahams
2025-04-10 20:32, user: ITAbrahams
2025-04-10 20:32, user: ITAbrahams
2025-04-10 21:45, user: talley
- removed protein AausGFP aliases: JFP, Jade Fluorescent Protein, wtJFP