compare

Comparison List

AausGFP

AausGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2019, derived from Aequorea australis. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea australis 27.5 kDa -

FPbase ID: D7QYG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
398 503 29,000 0.73 21.17 4.8    

Photostability

No photostability measurements available ... add one!

AausGFP Sequence

MKIYCEGEKLFKGIVPIQIELNGDVNGHKFSVHGEGQGEAEMGRLTLRFVCTTGKMPVPWPTLVTTFSYGVQCFSRYPEHMKMHDFFKSAMPEGYTQERTIFFDKDGTYKTRAEVKFEGDTLVNRIELTGTGFKEDGNILGHKMEYNYNSHNVYIMSDKAKNGIKVNFKIRHNIEDGTVQLADHYQANYPLGKGPVLLPEDHYLSTQSALTKDPHETRDHMLLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for AausGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change