compare

Comparison List

AausFP3

AausFP3 is a basic (constitutively fluorescent) fluorescent protein, derived from Aequorea australis. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea australis 25.5 kDa -

FPbase ID: OEVJT

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
587   59,000     6.5    

Photostability

No photostability measurements available ... add one!

AausFP3 Sequence

MACGALLFKGKIPFVVELEGDVNGEVFSVRGNGWGDGSTGKIEIKFVCTTGEIPVAWESLVCSLAYGALVFAKYPSNINDFFKSTMPKGYIQERNIQFENDGQYVTRAEVTYENGTLYNRVKLNGSGFRKDGNILGKKLDSTSLGTCIYIMGNDQGNGLKGVYNKAYKVIGGNRQLASHQQTHTPIGDGLVSIPDYHVMHNHIACSKDPSETRDHIIVKESLRAVDCNTEYM

Excerpts

No excerpts have been added for AausFP3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change