compare

Comparison List

anm1GFP2

anm1GFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Anthoathecata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Anthoathecata 25.0 kDa -

FPbase ID: YV34T

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 504          

Photostability

No photostability measurements available ... add one!

anm1GFP2 Sequence

MAEYFEKPLPYKVELEGDVDGQKFTVIGEGQGDASTGRVEGKYVCTKGEVPISWVSLITSLSYGGKCFVRYPNVIKDFFKSTFPTGYHQERKITYEDDGVLETAAKVTLESGAIYNRISVKGVGFKKDGNVCKKRLHSSPPQVSYVVPYGEGIRVLYSNIYPTKDGGYVVADTRQVNRPIKAEGKSAIPKYHYIKSKIDLSTDPNERKDHIIIKEVNVASGIDFS
GenBank: AAR85351
UniProtKB: Q6RYS5
IPG: 1978498

Excerpts

No excerpts have been added for anm1GFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change