compare

Comparison List

TagCFP

TagCFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2002, derived from Aequorea macrodactyla. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea macrodactyla 26.7 kDa -

FPbase ID: WRK8K

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
458 480 37,000 0.57 21.09 4.7    

Photostability

No photostability measurements available ... add one!

TagCFP Sequence

MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLESFSAYCHTHGMDELYR

Excerpts

No excerpts have been added for TagCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change