compare

Comparison List

YuzuFP

a.k.a. sfGFP H148S

YuzuFP is a basic (constitutively fluorescent) green fluorescent protein published in 2025, derived from Aequorea victoria. It is reported to be a rapidly-maturing monomer with high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.8 kDa -

FPbase ID: WQUOO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
492 511 61,400 0.92 56.49 6.2 16.0 2.76
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
206.0 NR Widefield HeLa Lifeact 37.0 Ahmed et al. (2025)
A caution on interpretation of photostability measurements
Add photostability info

YuzuFP Sequence

BLAST

YuzuFP was derived from Superfolder GFP with the following mutations: H148S

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSSNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKGSHHHHHH
GenBank: PV666611

Excerpts

No excerpts have been added for YuzuFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Molecular dynamics guided identification of a brighter variant of superfolder Green Fluorescent Protein with increased photobleaching resistance

Ahmed Rd, Jamieson Wd, Vitsupakorn D, Zitti A, Pawson Ka, Castell Ok, Watson Pd, Jones Dd

(2025). Communications Chemistry, 8(1) , 174. doi: 10.1038/s42004-025-01573-4. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change