compare

Comparison List

McaG1

McaG1 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 26.1 kDa -

FPbase ID: WKCO7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
492 514          

Photostability

No photostability measurements available ... add one!

McaG1 Sequence

MSVIKPDMKIKLRMEGAVNGHKFVIEGDGKGKPFEGKQTMDLTVIEGAPLPFAYDILTTVFDYGNRVFAKYPKDIPDYFKQTFPEGYSWERSMTYEDQGICIATNDITMMKGVDDCFVYKIRFDGVNFPANGPVMQRKTLKWEPSTEKMYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHRIEIVSPDKDYNKVKLYEHAEAHFGLPRQAK
GenBank: AAU04446
UniProtKB: Q66ND5
IPG: 3612569

Excerpts

No excerpts have been added for McaG1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change