compare

Comparison List

pporGFP

pporGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Porites porites.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Porites porites 24.7 kDa -

FPbase ID: W7ZR3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
495 507 98,200 0.54 53.03      

Photostability

No photostability measurements available ... add one!

pporGFP Sequence

MALSKQVTMKYHMDGRFEDKEFTIEGEGTGKPYEGKQTVTLWVTKGAPLPFSFDILSAVFLYGNRAFTDYPKGIVDYFKPSFPEGYSFERTLEFEDGGYCTASADISLDSASNCFIHKSSFKGVKFPDNGPVKQKKTTNWEPSIEKMTVRDGILKGDVTMFLSLTDGGNHRCQFSTLYKAKKAVKLPTESHYVEHRLVRTDLPNGKVQLEEHAAARLNTV
GenBank: ABB17964
UniProtKB: A8CLU1
IPG: 4901503

Excerpts

No excerpts have been added for pporGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change