compare

Comparison List

mmGFP

mmGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2004, derived from Meandrina meandrites.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Meandrina meandrites 23.7 kDa -

FPbase ID: U5ALR

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
398 505 0.645     1440.0 3.1
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mmGFP Sequence

BLAST
MAVPTQVKMKYSMDGNFNGQSFTVVGEGTGNPYEGHQSLKLTVKGEPLPFAFDILSATFTYGNRVFTKYPEGKTDYFKEAFPGGLTWERTMTFEDGGICTVAAEISLTGSVFEHKSKFVGVNFPANGPVIQKKTLGWETSTEKMAANDGSVQGYDTMFLKLEGGGRHKCYFVTNHKAKRAVKVPDNHFVWHRLVRNGDGNTVELEETAEARYDS
GenBank: AAO00732
UniProtKB: Q86LV8
IPG: 938781

Excerpts

No excerpts have been added for mmGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Biophysical characterization of natural and mutant fluorescent proteins cloned from zooxanthellate corals

Sun Y, Castner Ew, Lawson Cl, Falkowski Pg

(2004). FEBS Letters, 570(1-3) , 175-183. doi: 10.1016/j.febslet.2004.06.043. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change