compare

Comparison List

mKelly2

mKelly2 is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 24.7 kDa -

FPbase ID: T9G4X

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 649 43,000 0.18 7.74 5.6 20.0  

Photostability

No photostability measurements available ... add one!

mKelly2 Sequence

mKelly2 was derived from mKelly1 with the following mutations: H72Y/T146Y/V155E/R157T/K192E/Y193H
amino acid numbers relative to eqFP578. show relative to mKelly1

MELIKENMRMKLYMEGTVGNHHFKCTAEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATCFMYGSKTFINYPQGIPDFFKQSFPEGFTWERVTTYEDGGVLTVTQDTSLQDGYLIYNVKLRGVNFPSNGPVMQKKTLGWEPTTEYLVPVDGGLEGTCDMALRLVGGGHLKCNLKTTYRSKKPAKNLKMPGEHQVDRKLERIKEADNETYVEQHEVAVAR
GenBank: MK040732

Excerpts

No excerpts have been added for mKelly2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomerization of far-red fluorescent proteins

Wannier Tm, Gillespie Sk, Hutchins N, Mcisaac Rs, Wu S-Y, Shen Y, Campbell Re, Brown Ks, Mayo Sl

(2018). Proceedings of the National Academy of Sciences, 115(48) , E11294-E11301. doi: 10.1073/pnas.1807449115. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change