compare

Comparison List

Fpcondchrom

Fpcondchrom is a basic (constitutively fluorescent) fluorescent protein published in 2004, derived from Condylactis gigantea.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Condylactis gigantea 25.4 kDa -

FPbase ID: T939F

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
             

Photostability

No photostability measurements available ... add one!

Fpcondchrom Sequence

MAGLLKESMRIKIYMEGTVNGYHFKCEGEGDGNPFEGTQNMRIRVTEGAPLPFAFDILSPCCAYGSKTFIKHTSGIPDYFKRSFPEGFTWEGTTIYEDGRVLTAHQDTSLEGNCPIYKVKVLGTNFPAASPVMKKVSGGWEPSTEIVYQDNGVLRGRNVMALKVSGRPPLICHLHSTYRSKKACALTMPGFHFADLRIQMPKKKKDEYFELYEASVARYSDVPEKAT
GenBank: AAK71343
UniProtKB: Q8MU45
IPG: 1092052

Excerpts

No excerpts have been added for Fpcondchrom
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change