compare

Comparison List

afraGFP

afraGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Agaricia fragilis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Agaricia fragilis 25.7 kDa -

FPbase ID: T5A9C

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 503 100,800 0.61 61.49      

Photostability

No photostability measurements available ... add one!

afraGFP Sequence

MSVIVKEMMTKLHMEGTVNGHAFTIEGKGKGDPYNGVQSMNLDVKGGAPLPFSFDLLTPAFMYGNRVFTKYPEDIPDFFKQVFPEGYHWERSITFEDQAVCTATSHIRLDQKEMCFIYDVRFHGVNFPANGPIMQKKILGWEPSTEKMYARDGVLKGDVNMTLRVEGGGHYRADFRTTYKAKKPVNLPGYHFIDHRIEITKHSKDYTNVALYEAAVARHSPLPKVA
GenBank: AAU06857
UniProtKB: Q66PU5
IPG: 3620756

Excerpts

No excerpts have been added for afraGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change