compare

Comparison List

anm1GFP1

anm1GFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Anthoathecata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Anthoathecata 29.2 kDa -

FPbase ID: S1U3D

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
475 495 75,000 0.65 48.75      

Photostability

No photostability measurements available ... add one!

anm1GFP1 Sequence

MNVMRYNRGFCRVLQNGVKNLRSRNCSTEEKPVILGAMTETFQKKLPYKLELDGDVDGQTFKVIGEGVGDATTGVIEGKYVCTEGEVPISWVSLITSLSYGAKCFVRYPNEINDFFKSTFPSGYHQERKITYENDGVLETAAKITMESGAIVNRINVKGTGFDKDGHVCQKNLESSPPSTTYVVPEGEGIRIIYRNIYPTKDGHYVVADTQQVNRPIRAQGTSAIPTYHHIKSKVDLSTDPEENKDHIIIKETNCAFDADFS
GenBank: AAR85350
UniProtKB: Q6RYS6
IPG: 1978515

Excerpts

No excerpts have been added for anm1GFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change