compare

Comparison List

scubGFP1

scubGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2002, derived from Scolymia cubensis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Scolymia cubensis kDa -

FPbase ID: S1LK3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
497 506          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

scubGFP1 Sequence

BLAST
MQRAGMKVKEHMKIKLRMGGTVNGKHFAVNGTGDGYPYQGKQILKLIVEGSEPLPFAFDILSAAFQYGNRAFTEYPTEIADYFKQSFEFGEGFSWERSFTFEDGAICVATNDITMVGGEFQYDIRFDGLNFPXDGPVMQKKTVKWEPSTEIMYMQNGVLKGEVNMALLLXDKSHYRCDLKTTYKAKNNVPHPPGYHYVDHCIEILEERKDHVKLREHAKARSSLSPTSAKERKA
GenBank: AAK71333
UniProtKB: Q8T5F3
IPG: 1193179

Excerpts

No excerpts have been added for scubGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change