compare

Comparison List

pHmScarlet

pHmScarlet is a basic (constitutively fluorescent) red fluorescent protein published in 2021. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
? <add one> 26.4 kDa -

FPbase ID: RSRP9

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
pH 7.5 562 585 85,000 0.47 39.95 7.4    
pH 5 513 513          
pH 6 517 517          
pH 7 520 520          
pH 8 562 562          
pH 9 562 562          
pH 10 562 562          
pH 7.4 564 585          
Edit state transitions

Photostability

No photostability measurements available ... add one!

pHmScarlet Sequence

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASCERLYPEDGVLKGDILKVLRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRQLTITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

No excerpts have been added for pHmScarlet
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change