compare

Comparison List

mNeptune681

mNeptune681 is a basic (constitutively fluorescent) far red fluorescent protein published in 2016, derived from Entacmaea quadricolor. It has high acid sensitivity.
+
mNeptune681 Spectrum Fluorescent protein mNeptune681 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.5 kDa -

FPbase ID: REVUQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
604 681 38,000 0.04 1.52 7.3    

Photostability

No photostability measurements available ... add one!

mNeptune681 Sequence

mNeptune681 was derived from mNeptune with the following mutations: G41Q/S143N/E155R/R157H/C158N/D159Q
amino acid numbers relative to eqFP578. show relative to mNeptune

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATCFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTETLYPADGGLRGHNQMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK

Excerpts

No excerpts have been added for mNeptune681
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Mutagenesis of mNeptune Red-Shifts Emission Spectrum to 681-685 nm

Li Zy, Zhang Zp, Bi Lj, Cui Zq, Deng Jy, Wang Db, Zhang X-E

(2016). PLOS ONE, 11(4) , e0148749. doi: 10.1371/journal.pone.0148749. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change