compare

Comparison List

mcFP503

mcFP503 is a fluorescent protein published in 2007, derived from Montastraea cavernosa.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.7 kDa -

FPbase ID: QX3LG

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mcFP503 Sequence

BLAST
MSVIKSVMKIKLRMDGIVNGHKFMITGEGEGKPFEGTHTIILKVKEGGPLPFAYDILTTAFQYGNRVFTKYPKDIPDYFKQSFPEGYSWERSMTFEDQGVCTVTSDIKLEGDCFFYEIRFYGVNFPSSGPVMQKKTLKWEPSTENMYVRDGVLLGDVNMALLLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHRIEIVSHDKDYNKVKLYEHAEAHSGLPRQAK
GenBank: ABS87207
UniProtKB: A7UAL2
IPG: 13509102

Excerpts

No excerpts have been added for mcFP503
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Dynamic Regulation of Fluorescent Proteins from a Single Species of Coral

Kao H-T, Sturgis S, Desalle R, Tsai J, Davis D, Gruber Df, Pieribone Va

(2007). Marine Biotechnology, 9(6) , 733-746. doi: 10.1007/s10126-007-9025-1. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change