compare

Comparison List

Sandercyanin

Sandercyanin is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2016, derived from Sander vitreus. It requires the cofactor biliverdin for fluorescence.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Sander vitreus 18.6 kDa Biliverdin

FPbase ID: P9LBW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
375 675 21,000 0.016 0.34      

Photostability

No photostability measurements available ... add one!

Sandercyanin Sequence

MFIKPGRCPKPAVQEDFDAARYLGVWYDIQRLPNKFQKGECATATYSLSPGVGFSVFNRERLANGTIKSVIGSAIAEDPCEPAKLQFFHENAAPVPYWVLSTDYDNYALVYSCINLGASHAAYASIVSRQPTLPEETIKKLQGTMSSFGVGVDTLLTTNQDAAYCSAMNQ

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Sandercyanin
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue protein with red fluorescence

Ghosh S, Yu C-L, Ferraro Dj, Sudha S, Pal Sk, Schaefer Wf, Gibson Dt, Ramaswamy S

(2016). Proceedings of the National Academy of Sciences, 113(41) , 11513-11518. doi: 10.1073/pnas.1525622113. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change