compare

Comparison List

smURFP_2.5

smURFP_2.5 is a basic (constitutively fluorescent) near ir fluorescent protein published in 2025, derived from Trichodesmium erythraeum IMS101. It requires the cofactor biliverdin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Trichodesmium erythraeum IMS101 15.9 kDa Biliverdin

FPbase ID: P2GXH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
642 672 160,000 0.32 51.2      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

smURFP_2.5 Sequence

BLAST

smURFP_2.5 was derived from smURFP with the following mutations: T12V/Q27H/R47A/L90I/T120I
amino acid numbers relative to TeAPCα. show relative to smURFP

MKTSEQRVNIAVLLTENKKKIVDKASHDLWRRHPDLIAPGGIAFSQADRALCLRDYGWFLHLITFCLLAGDKGPIESIGLISIREMYNSIGVPVPAMMESIRCLKEASLSLLDEEDANEIAPYFDYIIKAMSEFHHHHHH

Excerpts

No excerpts have been added for smURFP_2.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineering a Bright Near-Infrared Fluorescent Protein by Screening a Comprehensive Phenotypic Landscape

Kulhanek D, Wei Q, Head J, Hellinger J, Jansen Z, Gilmour A, Segall-Shapiro T, Brodbelt Js, Usama Sm, Thyer R

(2025). , , . doi: 10.1101/2025.11.25.690577. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change