compare

Comparison List

pmimGFP1

pmimGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Pontella mimocerami. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Pontella mimocerami 25.1 kDa -

FPbase ID: OW4TY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 505 79,000 0.92 72.68 5.3    

Photostability

No photostability measurements available ... add one!

pmimGFP1 Sequence

MPNMKLECRISGTMNGEEFELVGNGDGNTDEGRMTNKMKSTKGPLSFSPYLLSHVLGYGYYHYATFPAGYENVYLHAMKNGGYSNTRTERYEDGGIISATFNYRYEGDKIIGDFKVVGTGFPTNSIIFTDKIIKSNPTCEHIYPKADNILVNAYTRTWMLRDGGYYSAQVNNHMHFKSAIHPTMLQNGGSMFTYRKVEELHTQTEVGIVEYQHVFKTPTAFA
GenBank: ACT99046
UniProtKB: D2IGW0
IPG: 18218400

Excerpts

No excerpts have been added for pmimGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change