compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

pHluorin, ecliptic

a.k.a. ecliptic pHluorin, pHluorin

pHluorin, ecliptic is a multistate long stokes shift fluorescent protein published in 1998, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	27.0 kDa	-

FPbase ID: KPFB9

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
acidic	395	509
default	395	509				7.1

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

pHluorin, ecliptic Sequence

BLAST

pHluorin, ecliptic was derived from avGFP with the following mutations: Q80R/S147D/N149Q/V163A/S175G/S202F/Q204T/A206TQ80R/S147D/N149Q/V163A/S175G/S202F/Q204T/A206T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNDHQVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLFTTSTLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

GenBank: AAC40226

Excerpts

No excerpts have been added for pHluorin, ecliptic
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Visualizing secretion and synaptic transmission with pH-sensitive green fluorescent proteins

Miesenböck G, De Angelis Da, Rothman Je

(1998). Nature, 394(6689) , 192-195. doi: 10.1038/28190. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for pHluorin, ecliptic
Search RIKEN BRC for pHluorin, ecliptic

Change history

Something missing or incorrect? Submit a change Submit a change