compare

Comparison List

atenFP

atenFP is a basic (constitutively fluorescent) green fluorescent protein published in 2002, derived from Acropora tenuis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Acropora tenuis 24.6 kDa -

FPbase ID: J9SCM

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 515          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

atenFP Sequence

BLAST
MRTKYHMEGSVNGHEFTIEGVGTGNPYEGTQTAELVIIKPVGKPLPFSFDILSSVFQYGNLCFTKYPADMTDYFKQAFPAGMSYERSFLFEDGAVATASWNIRLEGNCFIHNSIFHGVNFPADGPVMKKKTIGWDKSFQKMTVSKEVLRGDLAMFLLLEGGGYHRCQFHSTYKTERPVTLPPNHVVEHQIVRTDLGQSAKGFTVKLEEHAAAHVNPLKVK
GenBank: BAM08940
UniProtKB: I0IUJ1
IPG: 27425393

Excerpts

No excerpts have been added for atenFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Separation of highly fluorescent proteins by SDS-PAGE in Acroporidae corals

Papina M, Sakihama Y, Bena C, Van Woesik R, Yamasaki H

(2002). Comparative Biochemistry and Physiology Part B: Biochemistry and Molecular Biology, 131(4) , 767-774. doi: 10.1016/s1096-4959(02)00025-8. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change