compare

Comparison List

dhorRFP

dhorRFP is a fluorescent protein published in 2008, derived from Danafungia horrida.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Danafungia horrida 24.7 kDa -

FPbase ID: GWQB2

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

dhorRFP Sequence

MALSKQAIGKDMKINYFMDGSVNGHEFTVKGEGIGKPYEGHHEMTLRVTMAKGGPLPFSFDLLSHTFCYGNRPFTKYPEEIPDYFKQAFPEGLSWERSLQFEDGGFAAVNANISLKGDCFEHNSKFVGVNFPAEGPVMQNKSLDWEPSTEKITVSDGVLKGDVPMFLKLVGGGNHKCQFTTTYKAAKKVLDMPQSHFIFHRLVRKTEGNITKLVEDVEAHN
GenBank: ABB17957
UniProtKB: A8CLQ6
IPG: 4901504

Excerpts

No excerpts have been added for dhorRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change