compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mCerulean2.N(T65S)

mCerulean2.N(T65S) is a basic (constitutively fluorescent) cyan fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.7 kDa	-

FPbase ID: EEJ9Q

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
439	481	43,000	0.46	19.78

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mCerulean2.N(T65S) Sequence

BLAST

mCerulean2.N(T65S) was derived from mCerulean2.N with the following mutations: T66ST65S
amino acid numbers relative to mCerulean2.NavGFP. show relative to avGFP show relative to mCerulean2.N

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAIHGNVYITADKQKNGIKANFGLNCNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSIQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCerulean2.N(T65S)
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An Improved Cerulean Fluorescent Protein with Enhanced Brightness and Reduced Reversible Photoswitching

Markwardt Ml, Kremers G-J, Kraft Ca, Ray K, Cranfill Pjc, Wilson Ka, Day Rn, Wachter Rm, Davidson Mw, Rizzo Ma

(2011). PLoS ONE, 6(3) , e17896. doi: 10.1371/journal.pone.0017896. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for mCerulean2.N(T65S)
Search RIKEN BRC for mCerulean2.N(T65S)

Change history

Something missing or incorrect? Submit a change Submit a change