compare

Comparison List

dis3GFP

dis3GFP is a basic (constitutively fluorescent) green fluorescent protein published in 2002, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Discosoma sp. 26.0 kDa -

FPbase ID: D41LA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
503 512          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

dis3GFP Sequence

BLAST
MSALKEEMKINLTMEGVVNGLPFKIRGDGKGKPYQGSQELTLTVVKGGPLPFSYDILTTMFQYGNRAFVNYPEDIPDIFKQTCSGPNGGYSWQRTMTYEDGGVCTATSNISVVGDTFNYDIHFMGANFPLDGPVMQKRTMKWEPSTEIMFERDGMLRGDIAMSLLLKGGGHYRCDFETIYKPNKVVKMPDYHFVDHCIEITSQQDYYNVVELTEVAEARYSSLEKIGKSKA
GenBank: AAM10627
UniProtKB: Q8T6T8
IPG: 1067021

Excerpts

No excerpts have been added for dis3GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change