compare

Comparison List

mc5

mc5 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2003, derived from Montastraea cavernosa.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Montastraea cavernosa 25.8 kDa -

FPbase ID: C36M3

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
435 495          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mc5 Sequence

BLAST
MSVIKSVMKIKLHMDGIVNGHKFMITGEGEGKPFEGTHTIILKVKEGGPLPFAYDILTTAFQYGNRVFTKYPKDIPDYFKQSFPEGYSWERSMTFEDQGVCTVTSDIKLEGDCFFYEIRFYGVNFPSSGPVMQKKTLKWEPSTENMYVRDGVLLGDVSRTLLLEGDKHHRCNFRSTYRAKKGVVLPEYHFVDHRIEILSHDKDYNTVEVYENAVARPSMLPSKAK
GenBank: AAO61602
UniProtKB: Q7Z0W5
IPG: 1678428

Excerpts

No excerpts have been added for mc5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Molecular Basis and Evolutionary Origins of Color Diversity in Great Star Coral Montastraea cavernosa (Scleractinia: Faviida)

Kelmanson Iv

(2003). Molecular Biology and Evolution, 20(7) , 1125-1133. doi: 10.1093/molbev/msg130. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change