compare

Comparison List

BFP.A5

BFP.A5 is a basic (constitutively fluorescent) blue fluorescent protein published in 2006, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: A6N87

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
383 447 27,400 0.48 13.15     3.27
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

BFP.A5 Sequence

BLAST

BFP.A5 was derived from BFP with the following mutations: F64L/F145A/V150I/V163A/V224R

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNANSHNIYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFRTAAGITHGMDELYK
GenBank: ABK79092
IPG: 6379405

Excerpts

No excerpts have been added for BFP.A5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue fluorescent proteins with enhanced brightness and photostability from a structurally targeted library

Mena Ma, Treynor Tp, Mayo Sl, Daugherty Ps

(2006). Nature Biotechnology, 24(12) , 1569-1571. doi: 10.1038/nbt1264. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change