compare

Comparison List

ECGFP

a.k.a. Enhanced Cyan-Green Fluorescent Protein

ECGFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2000, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 27.0 kDa -

FPbase ID: 9HU84

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
463 506 23,900 0.14 3.35 4.0    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

ECGFP Sequence

BLAST
MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: BAB11884

Excerpts

No excerpts have been added for ECGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Directed evolution of green fluorescent protein by a new versatile PCR strategy for site-directed and semi-random mutagenesis

Sawano A

(2000). Nucleic Acids Research, 28(16) , 78e-78. doi: 10.1093/nar/28.16.e78. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change