compare

Comparison List

NpR3784g

a.k.a. NpR3784 GAF Domain

NpR3784g is the GAF domain from the cyanobacteriochrome (CBCR) photoreceptor NpR3784 cloned from Nostoc punctiforme. It was used in the directed evolution of miRFP670Nano.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Nostoc punctiforme 17.1 kDa Biliverdin

FPbase ID: 7T72C

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

NpR3784g Sequence

BLAST

Note: This is just GAF domain from the wild-type NpR3784. Additionally, the sequence below is as shown in Oliinyk et al. (2019) and differs from RefSeq WP_012410140 by C119L

MANLDKVLNTTVTEVRQFLQVDRVFMYQFEPDYSGVVVVESVDDRWIAILNTQVQDTYFMETRGEEYSHGRIQAIADIYTAGLTECHRDLLTQFQVRANLAVPILQGKKLWGLLVANQLAAPRQWQTWEIDFLKQLAVQVGIAIQQSQL
GenBank: WP_012410140

Excerpts

No excerpts have been added for NpR3784g
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

NpR3784 is the prototype for a distinctive group of red/green cyanobacteriochromes using alternative Phe residues for photoproduct tuning

Rockwell Nc, Martin Ss, Gan F, Bryant Da, Lagarias Jc

(2015). Photochemical & Photobiological Sciences, 14(2) , 258-269. doi: 10.1039/c4pp00336e. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change