compare

Comparison List

mJuniper

a.k.a. mJun

mJuniper is a basic (constitutively fluorescent) cyan fluorescent protein published in 2024, derived from Aequorea victoria. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.
+
mJuniper Spectrum Fluorescent protein mJuniper excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.7 kDa -

FPbase ID: 6KPKA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 475 32,000 0.43 13.76 4.7 1.7  

Photostability

No photostability measurements available ... add one!

mJuniper Sequence

mJuniper was derived from mChartreuse with the following mutations: Y66W/S72A/N146F/H148D

MSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATIGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGSGFKEDGNILGHKLEYNYFSDKVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for mJuniper
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change