compare

Comparison List

ccalOFP1

ccalOFP1 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2008, derived from Corynactis californica.
+
ccalOFP1 Spectrum Fluorescent protein ccalOFP1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Corynactis californica 25.5 kDa -

FPbase ID: 5YBHO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 561 85,000 0.52 44.2      

Photostability

No photostability measurements available ... add one!

ccalOFP1 Sequence

MSLSKQVLPRDVKMRFHMDGCVNGHSFTIEGEGTGKPYEGKKTLKLRVTKGGPLPFAFDILSATFTYGNRCFCDYPEEMPDYFKQSLPEGYSWERTMMYEDGACSTASAHISLDKDCFIHNSTFHGVNFPANGPVMQKKAMNWEPSSELITPCDGILKGDVTMFLLQEGGHRHKCQFTTSYKAHKAVKIPPNHIIEHRLVRKEVGDAVQIQEHAVAKHFTVQIKEA
GenBank: AAZ14789
UniProtKB: Q1ALD3
IPG: 4535492

Excerpts

No excerpts have been added for ccalOFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change