compare

Comparison List

Fpaagar

Fpaagar is a fluorescent protein published in 2004, derived from Agaricia agaricites.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Agaricia agaricites kDa -

FPbase ID: 59JAS

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Fpaagar Sequence

MGRILILNPPSVNGIAEEMKTDLIMEGIVNGHSFTIEGKGTGYXYKGDQFMKLEVVKGAPLPFSFDILTTAFMYGNRVFTKYPSNIPDFFKQTFPEGYHWERIMPFEDQAVCTVTSHIRLEEKEEGEMRFVDNVKFHCVNFPPNGPVMQRKIMRWEPSTENMYPRNGLLEGYDEKTFRLKGGGYYQAEHKSIYEGKGSISMPDFHFIDHRIMITNHDEDYTNVELREVALARYSTLPPI
GenBank: AAK71341
UniProtKB: Q8MMA1
IPG: 447458

Excerpts

No excerpts have been added for Fpaagar
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change