compare

Comparison List

mBaoJin

a.k.a. mBJ, mStayGold

mBaoJin is a basic (constitutively fluorescent) green fluorescent protein published in 2024, derived from Cytaeis uchidae. It is reported to be a very rapidly-maturing monomer with low acid sensitivity.
+
mBaoJin Spectrum Fluorescent protein mBaoJin excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Cytaeis uchidae 26.6 kDa -

FPbase ID: 4XHVQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
500 508 128,000 0.93 119.04 4.37 7.6 3.1

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
1350.0 12.8 (mW/mm2) Other Widefield Zhang et al. (2024)

mBaoJin Sequence

mBaoJin was derived from StayGold with the following mutations: *0_M1insMVSKGEEEN/S55T/H75R/E80G/Q140P/H141Q/C165Y/N171Y/T201A/*218KextGMDELYK

MVSKGEEENMASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTTFGYGMKYYTKYPSGLKNWFREVMPGGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVPQIPRDDGVECPVTLLYPLLSDKSKYVEAHQYTICKPLHNQPAPDVPYHWIRKQYTQSKDDAEERDHICQSETLEAHLKGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mBaoJin
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change