compare

Comparison List

aeurGFP

aeurGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora eurystoma.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora eurystoma 26.0 kDa -

FPbase ID: 4NRYW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 515 145,700 0.67 97.62      

Photostability

No photostability measurements available ... add one!

aeurGFP Sequence

MSYSKQGIVQEMKTKYHMEGSVNGHEFTIEGVATGYPYEGKQMSELVIIKPKGKPLPFSFDILSSVFQYGNRCFTKYPADIPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHNSIFHGVNFPADGPVMKKQTIGWDKSFEKMTVSKEVLRGDVTMFLMLEGGGYHRCQFHSTYKTEKPVTLPPNHVVEHQIVRTDLGQSAKGFTVKLEALAAAHVNPLKVQ
GenBank: ACD13192
UniProtKB: B6CTZ3
IPG: 14926073

Excerpts

No excerpts have been added for aeurGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change