compare

Comparison List

aacuGFP2

aacuGFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora aculeus.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora aculeus 26.1 kDa -

FPbase ID: 3W5ZV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
502 513 93,900 0.71 66.67      

Photostability

No photostability measurements available ... add one!

aacuGFP2 Sequence

MSYSKQGIVQEMKTKYRMEGSVNGHEFTIEGVGTGYPYEGKQMSELVIIKPKGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHNSIFHGVNFPADGPVMKKKTIGWDKSFEKMTVSKEVLRGDVTMFLMLEGGGYHRCQFHSTYKTEKPVELPPNHVVEHQIVRTDLGQSAKGFTVKLEAHAAAHVNPLKVQ
GenBank: AAU06845
UniProtKB: Q66PV9
IPG: 3620755

Excerpts

No excerpts have been added for aacuGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change