compare

Comparison List

mKelly1

mKelly1 is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
mKelly1 Spectrum Fluorescent protein mKelly1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 24.7 kDa -

FPbase ID: 3PP3A

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
596 656 44,000 0.16 7.04 5.4 28.0  

Photostability

No photostability measurements available ... add one!

mKelly1 Sequence

mKelly1 was derived from mCardinal with the following mutations: V1a_E2del/H10R/N20G/T28A/T73P/C114Y/A142P/Y148V/A150V/E155V/K163R/H171K/V192K/F194Q/R198K/Y221_K231del
amino acid numbers relative to eqFP578. show relative to mCardinal

MELIKENMRMKLYMEGTVGNHHFKCTAEGEGKPYEGTQTQRIKVVEGGPLPFAFDILATCFMYGSKTFINHPQGIPDFFKQSFPEGFTWERVTTYEDGGVLTVTQDTSLQDGYLIYNVKLRGVNFPSNGPVMQKKTLGWEPTTETLVPVDGGLVGRCDMALRLVGGGHLKCNLKTTYRSKKPAKNLKMPGKYQVDRKLERIKEADNETYVEQHEVAVAR
GenBank: MK040731

Excerpts

No excerpts have been added for mKelly1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomerization of far-red fluorescent proteins

Wannier Tm, Gillespie Sk, Hutchins N, Mcisaac Rs, Wu S-Y, Shen Y, Campbell Re, Brown Ks, Mayo Sl

(2018). Proceedings of the National Academy of Sciences, 115(48) , E11294-E11301. doi: 10.1073/pnas.1807449115. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change