compare

Comparison List

eechGFP2

eechGFP2 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2008, derived from Echinophyllia echinata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Echinophyllia echinata 25.5 kDa -

FPbase ID: 37XMD

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
506 520 109,800 0.69 75.76      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

eechGFP2 Sequence

BLAST
MNVIKPDMKIKLRMEGAVNGHKFAIEGEGNGQPFEGKQTMNLKVKEGGPLPFAYDILTTIFNYGNRVFVKYPDDIVDYFKQSFPEGYSWERSMIYEDGGICIATNDITLEGDCFVYKIRFDGVNFPAKSPVLQKMTKKWEPSTEKLYVRDGVLKGDVNMALLLEGGGHFRCDFKTTYKAKKVVQLPDYHFVDHRIEIMSHDKDYNNVKLCEHAEAHSGLPGQAK
GenBank: ABB17968
UniProtKB: A8CLW1
IPG: 4901521

Excerpts

No excerpts have been added for eechGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and Evolution of Coral Fluorescent Proteins

Alieva No, Konzen Ka, Field Sf, Meleshkevitch Ea, Hunt Me, Beltran-Ramirez V, Miller Dj, Wiedenmann J, Salih A, Matz Mv

(2008). PLoS ONE, 3(7) , e2680. doi: 10.1371/journal.pone.0002680. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change