compare

Comparison List

mScarlet-2A

mScarlet-2A is a basic (constitutively fluorescent) red fluorescent protein published in 2023, derived from synthetic construct.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 2G7N6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
568 592 97,000 0.685 66.44      

Photostability

No photostability measurements available ... add one!

mScarlet-2A Sequence

mScarlet-2A was derived from mScarlet-220A with the following mutations: T107S/G156V/V196I/E219V

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVSVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDVVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNIDRKLDITSHNEDYTVVEQYERSVARHSTGGMDELYK

Excerpts

No excerpts have been added for mScarlet-2A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change