compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

KOFP-7

This protein has unmoderated changes.

KOFP-7 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2020, derived from Pseudomonas putida. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Pseudomonas putida	16.7 kDa	Flavin

FPbase ID: 25HRD

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
450	496		0.61

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

KOFP-7 Sequence

BLAST

MSPMINAKLLQLMVEYSNDGIVVAEPEGNESILIYVNPAFERLTGYCADDILYQDGRFLQGEDHDQPGIAIIREAIREGRPCCQVLRNYRKDGSLFWNELSITPVHNEADRLTYFIGTQRDVTAQVFAEERMRELEAEVAELRRQ

Excerpts

No excerpts have been added for KOFP-7
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Discovery of Novel Pseudomonas putida Flavin-Binding Fluorescent Protein Variants with Significantly Improved Quantum Yield

Ko S, Jeon H, Yoon S, Kyung M, Yun H, Na J-H, Jung St

(2020). Journal of Agricultural and Food Chemistry, 68(21) , 5873-5879. doi: 10.1021/acs.jafc.0c00121. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for KOFP-7
Search RIKEN BRC for KOFP-7

Change history

Something missing or incorrect? Submit a change Submit a change