compare

Comparison List

superecliptic pHluorin

superecliptic pHluorin is a multistate green fluorescent protein published in 2002, derived from Aequorea victoria. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: 1Q7JU

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 511 37,000 0.8 29.6 7.0    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

superecliptic pHluorin Sequence

BLAST

superecliptic pHluorin was derived from pHluorin, ecliptic with the following mutations: F64L/S65T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNDHQVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLFTTSTLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: AY533296

Excerpts

No excerpts have been added for superecliptic pHluorin
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Transmission of Olfactory Information between Three Populations of Neurons in the Antennal Lobe of the Fly

Ng M, Roorda Rd, Lima Sq, Zemelman Bv, Morcillo P, Miesenböck G

(2002). Neuron, 36(3) , 463-474. doi: 10.1016/s0896-6273(02)00975-3. Article   Pubmed

Additional References

  1. Rational Engineering of an Improved Genetically Encoded pH Sensor Based on Superecliptic pHluorin

    Shen Y, Wen Y, Sposini S, Vishwanath Aa, Abdelfattah As, Schreiter Er, Lemieux Mj, De Juan-Sanz J, Perrais D, Campbell Re

    (2023). ACS Sensors, 8(8) , 3014-3022. doi: 10.1021/acssensors.3c00484. Article   Pubmed

  2. The Use of pHluorins for Optical Measurements of Presynaptic Activity

    Sankaranarayanan S, De Angelis D, Rothman Je, Ryan Ta

    (2000). Biophysical Journal, 79(4) , 2199-2208. doi: 10.1016/s0006-3495(00)76468-x. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change