compare

Comparison List

BrUSLEE

BrUSLEE is a basic (constitutively fluorescent) green fluorescent protein published in 2018, derived from Aequorea victoria.
+
BrUSLEE Spectrum Fluorescent protein BrUSLEE excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: 1K2R7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
487 509 86,000 0.3 25.8     0.82

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
90.0 NR Arc-lamp Widefield HEK 293T 25.0 Mamontova et al. (2018)

BrUSLEE Sequence

BrUSLEE was derived from EGFP with the following mutations: T65G/Y145M/F165Y
amino acid numbers relative to avGFP. show relative to EGFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNMNSHNVYIMADKQKNGIKVNYKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for BrUSLEE
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Bright GFP with subnanosecond fluorescence lifetime

Mamontova Av, Solovyev Id, Savitsky Ap, Shakhov A, Lukyanov Ka, Bogdanov Am

(2018). Scientific Reports, 8(1) , 13224. doi: 10.1038/s41598-018-31687-w. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change