compare

Comparison List

GFP(E222G)

GFP(E222G) is a basic (constitutively fluorescent) green fluorescent protein published in 2000, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.8 kDa -

FPbase ID: 1EOAR

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
481 506          

Photostability

No photostability measurements available ... add one!

GFP(E222G) Sequence

GFP(E222G) was derived from avGFP with the following mutations: E222G

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLGFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for GFP(E222G)
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Green-fluorescent protein mutants with altered fluorescence excitation spectra

Ehrig T, O'Kane Dj, Prendergast Fg

(2000). FEBS Letters, 367(2) , 163-166. doi: 10.1016/0014-5793(95)00557-p. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change